PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000143156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 257aa    MW: 29273.9 Da    PI: 8.1071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000143156genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv+ v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
    MDP0000143156 10 KGPWTEQEDFQLVCFVGLFGDRRWDFIAKVSGLKRTGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding55.81.1e-1763108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
    MDP0000143156  63 RGKMTPQEERLVLELHTKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 108
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.174557IPR017930Myb domain
SuperFamilySSF466891.31E-288104IPR009057Homeodomain-like
SMARTSM007171.2E-14959IPR001005SANT/Myb domain
PfamPF002494.2E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-191164IPR009057Homeodomain-like
CDDcd001674.27E-101257No hitNo description
PROSITE profilePS5129427.05458112IPR017930Myb domain
SMARTSM007172.4E-1662110IPR001005SANT/Myb domain
PfamPF002492.6E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2465111IPR009057Homeodomain-like
CDDcd001674.20E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MVQDQEQIRK GPWTEQEDFQ LVCFVGLFGD RRWDFIAKVS GLKRTGKSCR LRWVNYLHPG  60
LKRGKMTPQE ERLVLELHTK WGNRWSRIAR KLPGRTDNEI KNYWRTHMRK KAQEKKRAVS  120
PSSSSSNCSS SSNITTAEGG ASFYDTGGKE TKALSGGKKT GGGDDAKENE KREQGEYSLD  180
DIWKDINLPE VNIIEPVYDG NLSSCPLMAS PTPWEYCSDL LWKMDEEEES KNMFLPTPSG  240
DHQFLSCYEY GKASLTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-28101124105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155162GGKKTGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008357764.10.0PREDICTED: transcription factor MYB59 isoform X1
SwissprotQ9LX827e-91MYB48_ARATH; Transcription factor MYB48
TrEMBLM5W1561e-130M5W156_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_06s0004g04140.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.15e-88myb domain protein 48